PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0042s0042.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family ARR-B
Protein Properties Length: 815aa    MW: 87744.6 Da    PI: 6.1614
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0042s0042.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.43.2e-28296349155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kpr++W+ eLH++Fv+av++L G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Sphfalx0042s0042.1.p 296 KPRVVWSVELHQKFVSAVNEL-GIDKAVPKRILELMSVHGLTRENVASHLQKYRL 349
                           79*******************.********************************8 PP

2Response_reg77.25.9e-261132211109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           +l+vdD+ + + +l+++l++  y +v+++  ++ alell+e +  +Dl++ D+ mp+mdG++ll+     e++lp+i+++++ge + + 
  Sphfalx0042s0042.1.p 113 ILVVDDDLICLAILQKMLQHCSY-QVTTCGRATRALELLREDKdkFDLVISDVYMPDMDGFRLLELVGL-EMDLPVIMMSGNGETSVVM 199
                           89*********************.***************888778*******************87754.558**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + +  Ga d+l Kp+ +eel++
  Sphfalx0042s0042.1.p 200 KGITHGACDYLLKPVRIEELRN 221
                           ********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363928.5E-15690810IPR017053Response regulator B-type, plant
SuperFamilySSF521724.7E-36110235IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.1E-42110245No hitNo description
SMARTSM004482.0E-31111223IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.01112227IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.8E-23113222IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.85E-27114226No hitNo description
PROSITE profilePS5129412.069293352IPR017930Myb domain
SuperFamilySSF466896.63E-19293353IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-29295354IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-24296349IPR006447Myb domain, plants
PfamPF002495.8E-7298348IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 815 aa     Download sequence    Send to blast
MVVYTMIGGD ESLRSESFRE GTPDLEPAMA GSSVHQPQQQ QTNHQLQLYN SHQPKNLQQQ  60
QQHEAHQQQP HCSSVESTPH CNNTSASRAA AAAATSYGKM EPHTDDFPAG LRILVVDDDL  120
ICLAILQKML QHCSYQVTTC GRATRALELL REDKDKFDLV ISDVYMPDMD GFRLLELVGL  180
EMDLPVIMMS GNGETSVVMK GITHGACDYL LKPVRIEELR NIWQHVVRKL RSEPKEHSAS  240
FEEGERHKRD GAEDADNMSS ATNNADGNWR NKKKKEAKED EDDFELDNDD PSTLKKPRVV  300
WSVELHQKFV SAVNELGIDK AVPKRILELM SVHGLTRENV ASHLQKYRLY LKRLSGVTCQ  360
PNNLSVSFGG QDVGYGSLIG LDEMLDYRTL ATNGHLPAQT IAALHHANMV GRLGASSGMV  420
GLSGPLDPSM LGQLATLQSV PSPLPRPRID GSLLGNQAGL LQSLSGALDF NPVRQSHVLT  480
GIGPLGQEDD FPRLKAMQHQ LGMGSLGGLN RNNLAGSSPS EELTIQLLQQ RAQQQGGGST  540
VNLPQATGIL RPCSSDINLG QAGPMPSLVG LIPGTATGLS NMCPSRRQFG SSSSLSTSLG  600
TLMQSSIAKA QNLNFVGSSG SSGCSFQALS SKVGGLEDLN PTKRIRTICG ALSHSRPGLG  660
QSTAQITWPG RLGSQGGLGQ GELEHGGDSP NQVSSASHNL AGANGSSGQP AFMSSYGMGS  720
MGLNFPSSVT LDGGVVRTSL NRDQAMANTE QKFLKQEQSR DNLMCTKLEG DLMSNETTSE  780
ELLNYYSRQS QEGMGLVEGD FMSDGFPLGN LYVK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-22295355464ARR10-B
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1269275RNKKKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S10_278V6.11e-151(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.11e-109response regulator 1